Recombinant Human MIF Protein

EC 5.3.2.1 | EC 5.3.3.12 | GIFmacrophage migration inhibitory factor | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | macrophage migration inhibitory factor (glycosylation-inhibiting factor) | MIF | MMIF | Phe

rp214395-10μg

10μg

无载体

≥95%(SDS-PAGE)

MIF (or macrophage migration inhibitory factor) was the first lymphokine/cytokine to be recognized in the pregenomics era. Regardless, it is one of the least understood of all inflammatory mediators. Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without a signal sequence. Secretion occurs nonclassically via an ABCA1 transporter. The initiating Met is removed, leaving Pro as the first amino acid. The molecule consists of two alpha-helices and six beta-strands, four of which form a beta-sheet. The two remaining beta-strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position #1. Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity. MIF has proinflammatory cytokine activity centered around aa’s 49 - 65. On fibroblasts, MIF induces, IL-1, IL-8 and MMP expression; on macrophages, MIF stimulates NO production and TNF-alpha release following IFN-gamma activation. MIF apparently acts through CD74 and CD44, likely in some form of trimeric interaction. Human MIF is active on mouse cells. Human MIF is 90%, 94%, 95%, and 90% aa identical to mouse, bovine, porcine and rat MIF, respectively.

Immobilized Recombinant Human MIF Protein (rp214395) at 1.0 μg/mL can bind Recombinant MIF Antibody (Ab115362) with the EC50 of 4.3 ng/mL.

重组表达

13.5 kDa

N-8His

12.0 kDa, under reducing conditions; 12.0 kDa, under non-reducing conditions.

E. coli Accession #: P14174 | E. coli

<1.0 EU/μg

人(Human)

2-115 aa (N106S)

MHHHHHHHHPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAASVGWNNSTFA

No

Yes