Recombinant Human 14-3-3 beta/alpha Protein

14-3-3 alpha | 14-3-3 protein beta/alpha | 1433B_HUMAN | Brain protein 14-3-3 beta isoform | GW128 | HS 1 | KCIP-1 | KCIP1 | N-terminally processed | Protein 1054 | Protein kinase C inhibitor protein 1 | YWHAA | YWHAB

rp214462-10μg

10μg

无载体

≥90%(SDS-PAGE)

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13. Post-translational: The alpha, brain-specific form differs from the beta form in being phosphorylated. Phosphorylated on Ser-60 by protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion.

重组表达

28.9 kDa

N-His

27.9 kDa, under reducing conditions; 27.5 & 28.1 & 54.3 kDa, under non-reducing conditions.

E. coli Accession #: P31946 | E. coli

<1.0 EU/μg

人(Human)

2-246 aa

MHHHHHHTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

No

Yes